PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G15850.1
Common NameATCOL1, BBX2, COL1, F14F8_230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CO-like
Protein Properties Length: 355aa    MW: 39490.9 Da    PI: 6.4995
Description CONSTANS-like 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G15850.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.22.5e-061052440
     zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                 + C+++ +   + +C+ ++ +lC +C  + H        H++v
  AT5G15850.1 10 QACDTCRSAACTVYCRADSAYLCSSCDAQVHAAnrlasrHERV 52
                 57******99*********************556788888776 PP

2zf-B_box36.97.3e-125297342
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                  r+C+ +e+ ++ +fC+ +   lC +C +e+H+       H++vp+
  AT5G15850.1 52 VRVCQSCERAPAAFFCKADAASLCTTCDSEIHSAnplarrHQRVPI 97
                 689*****************************66899999**9997 PP

3CCT661.1e-22286329144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  Rea++lRY+eK+k RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  AT5G15850.1 286 REARVLRYREKKKMRKFEKTIRYASRKAYAEKRPRIKGRFAKKK 329
                  9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003365.3E-8754IPR000315B-box-type zinc finger
PROSITE profilePS5011910.836754IPR000315B-box-type zinc finger
CDDcd000215.89E-81254No hitNo description
PROSITE profilePS5011912.3585097IPR000315B-box-type zinc finger
PfamPF006433.3E-95297IPR000315B-box-type zinc finger
CDDcd000212.74E-95397No hitNo description
SMARTSM003367.1E-135597IPR000315B-box-type zinc finger
PfamPF062039.7E-17286328IPR010402CCT domain
PROSITE profilePS5101716.539286328IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0042802Molecular Functionidentical protein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MLKVESNWAQ ACDTCRSAAC TVYCRADSAY LCSSCDAQVH AANRLASRHE RVRVCQSCER  60
APAAFFCKAD AASLCTTCDS EIHSANPLAR RHQRVPILPI SEYSYSSTAT NHSCETTVTD  120
PENRLVLGQE EEDEDEAEAA SWLLPNSGKN SGNNNGFSIG DEFLNLVDYS SSDKQFTDQS  180
NQYQLDCNVP QRSYGEDGVV PLQIEVSKGM YQEQQNFQLS INCGSWGALR SSNGSLSHMV  240
NVSSMDLGVV PESTTSDATV SNPRSPKAVT DQPPYPPAQM LSPRDREARV LRYREKKKMR  300
KFEKTIRYAS RKAYAEKRPR IKGRFAKKKD VDEEANQAFS TMITFDTGYG IVPSF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1293299REKKKMR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.244860.0flower| leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306855620.0
Genevisible246523_at0.0
Expression AtlasAT5G15850-
AtGenExpressAT5G15850-
ATTED-IIAT5G15850-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed throughout development.
UniprotTISSUE SPECIFICITY: Highly expressed in leaves and at lower levels in stems, flowers and siliques. Not detected in roots.
Functional Description ? help Back to Top
Source Description
TAIRHomologous to the flowering-time gene CONSTANS.
UniProtPutative transcription factor that may be involved in the light input to the circadian clock but does not affect flowering time.
Function -- GeneRIF ? help Back to Top
  1. The data demonstrate that ax6 enhances the effect of coi1 on JA responses, implying a genetic interaction between COI1 and AtCUL1 in JA signaling.
    [PMID: 15860010]
  2. Both COL1 and COR27 were found to be regulated by the circadian clock at warm growth temperatures.
    [PMID: 19566593]
  3. our data demonstrate a role for COI1 in disease resistance independent of Jasmonic Acid signaling and provide a molecular link between the JA and NB-LRR signaling pathways.
    [PMID: 23093946]
  4. The lack of flowering promotion activity by COL1 and COL2 is mainly attributed to the differences between CO and the COL1 and COL2 proteins in the amino acid sequence encoded by their first exons.
    [PMID: 23265320]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G15850.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT5G47220(A)
Interaction -- BIND ? help Back to Top
Source Intact With Description
BINDAT5G62430CDF1 binds to CO promoter.
Interaction ? help Back to Top
Source Intact With
IntActSearch O50055
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G15850
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0743690.0AY074369.1 Arabidopsis thaliana putative CONSTANS 1 protein (At5g15850) mRNA, complete cds.
GenBankBT0023630.0BT002363.1 Arabidopsis thaliana clone U10630 putative CONSTANS 1 protein (At5g15850) mRNA, complete cds.
GenBankY105550.0Y10555.1 A.thaliana mRNA for CONSTANS like 1 (COL1) protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197089.10.0zinc finger protein CONSTANS-LIKE 1
SwissprotO500550.0COL1_ARATH; Zinc finger protein CONSTANS-LIKE 1
TrEMBLD7M7G90.0D7M7G9_ARALL; Putative uncharacterized protein
STRINGAT5G15850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Representative plantOGRP6911767
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ledger S,Strayer C,Ashton F,Kay SA,Putterill J
    Analysis of the function of two circadian-regulated CONSTANS-LIKE genes.
    Plant J., 2001. 26(1): p. 15-22
    [PMID:11359606]
  3. Osterberg MK,Shavorskaya O,Lascoux M,Lagercrantz U
    Naturally occurring indel variation in the Brassica nigra COL1 gene is associated with variation in flowering time.
    Genetics, 2002. 161(1): p. 299-306
    [PMID:12019243]
  4. Griffiths S,Dunford RP,Coupland G,Laurie DA
    The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis.
    Plant Physiol., 2003. 131(4): p. 1855-67
    [PMID:12692345]
  5. Feng S, et al.
    The COP9 signalosome interacts physically with SCF COI1 and modulates jasmonate responses.
    Plant Cell, 2003. 15(5): p. 1083-94
    [PMID:12724535]
  6. Kim SJ,Moon J,Lee I,Maeng J,Kim SR
    Molecular cloning and expression analysis of a CONSTANS homologue, PnCOL1, from Pharbitis nil.
    J. Exp. Bot., 2003. 54(389): p. 1879-87
    [PMID:12837818]
  7. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  8. Ren C, et al.
    Point mutations in Arabidopsis Cullin1 reveal its essential role in jasmonate response.
    Plant J., 2005. 42(4): p. 514-24
    [PMID:15860010]
  9. Fukamatsu Y, et al.
    Identification of LOV KELCH PROTEIN2 (LKP2)-interacting factors that can recruit LKP2 to nuclear bodies.
    Plant Cell Physiol., 2005. 46(8): p. 1340-9
    [PMID:15937324]
  10. Imaizumi T,Schultz TF,Harmon FG,Ho LA,Kay SA
    FKF1 F-box protein mediates cyclic degradation of a repressor of CONSTANS in Arabidopsis.
    Science, 2005. 309(5732): p. 293-7
    [PMID:16002617]
  11. McGrath KC, et al.
    Repressor- and activator-type ethylene response factors functioning in jasmonate signaling and disease resistance identified via a genome-wide screen of Arabidopsis transcription factor gene expression.
    Plant Physiol., 2005. 139(2): p. 949-59
    [PMID:16183832]
  12. Laubinger S, et al.
    Arabidopsis SPA proteins regulate photoperiodic flowering and interact with the floral inducer CONSTANS to regulate its stability.
    Development, 2006. 133(16): p. 3213-22
    [PMID:16854975]
  13. Chia TY,M
    Sugar beet contains a large CONSTANS-LIKE gene family including a CO homologue that is independent of the early-bolting (B) gene locus.
    J. Exp. Bot., 2008. 59(10): p. 2735-48
    [PMID:18495636]
  14. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  15. Zhu D, et al.
    Biochemical characterization of Arabidopsis complexes containing CONSTITUTIVELY PHOTOMORPHOGENIC1 and SUPPRESSOR OF PHYA proteins in light control of plant development.
    Plant Cell, 2008. 20(9): p. 2307-23
    [PMID:18812498]
  16. Mikkelsen MD,Thomashow MF
    A role for circadian evening elements in cold-regulated gene expression in Arabidopsis.
    Plant J., 2009. 60(2): p. 328-39
    [PMID:19566593]
  17. Khanna R, et al.
    The Arabidopsis B-box zinc finger family.
    Plant Cell, 2009. 21(11): p. 3416-20
    [PMID:19920209]
  18. Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
    14-3-3 proteins fine-tune plant nutrient metabolism.
    FEBS Lett., 2011. 585(1): p. 143-7
    [PMID:21094157]
  19. He Y,Chung EH,Hubert DA,Tornero P,Dangl JL
    Specific missense alleles of the arabidopsis jasmonic acid co-receptor COI1 regulate innate immune receptor accumulation and function.
    PLoS Genet., 2012. 8(10): p. e1003018
    [PMID:23093946]
  20. Kim SK,Park HY,Jang YH,Lee JH,Kim JK
    The sequence variation responsible for the functional difference between the CONSTANS protein, and the CONSTANS-like (COL) 1 and COL2 proteins, resides mostly in the region encoded by their first exons.
    Plant Sci., 2013. 199-200: p. 71-8
    [PMID:23265320]
  21. K MJ,Laxmi A
    DUF581 is plant specific FCS-like zinc finger involved in protein-protein interaction.
    PLoS ONE, 2014. 9(6): p. e99074
    [PMID:24901469]
  22. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  23. Moon YH,Chae S,Jung JY,An G
    Expressed sequence tags of radish flower buds and characterization of a CONSTANS LIKE 1 gene.
    Mol. Cells, 1998. 8(4): p. 452-8
    [PMID:9749533]